- Recombinant Methanothermobacter thermautotrophicus UPF0059 membrane protein MTH_1812 (MTH_1812)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1002122
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 19,965 Da
- E Coli or Yeast
- 1-184
- UPF0059 membrane protein MTH_1812 (MTH_1812)
Sequence
MDLLSMVLIGVGLAMDAFSISVSRGLALHESETNYALISALSFGTFQAAMPVLGWVSGLEIQRLVSALAPWAAFILLLIIGLKMIYESLIMEEEEFIFSYRELLVLSIATSIDAFAVGVSFALLDISIWLPVIVIGLITFILSLAGSYIGERVGHIFENRLEALGGLILILIGLKILLENVSFT